PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00995g00034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 245aa    MW: 27867.3 Da    PI: 7.3018
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00995g00034.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.58.5e-103277247
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              ++WT++E+ l++++ k +G+g W++I++      t+ q+  + qky
  Peaxi162Scf00995g00034.1 32 NPWTEDEHRLFLRGMKIHGKGKWTKISKDCLPSGTPQQIACHAQKY 77
                              69*************************9654355888888888887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9472682IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-102777IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-112980IPR006447Myb domain, plants
SuperFamilySSF466899.72E-132982IPR009057Homeodomain-like
SMARTSM007171.4E-63080IPR001005SANT/Myb domain
PfamPF002491.2E-73277IPR001005SANT/Myb domain
CDDcd001675.51E-83378No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRISEKNKK IKLFGVDTKN SENYGRKIKK SNPWTEDEHR LFLRGMKIHG KGKWTKISKD  60
CLPSGTPQQI ACHAQKYFIR LTETNERRRR NKPSVFDVNL ENTEEISEEN SNVVSEHAIV  120
PLKNQEHYDN TVSLENQEHN DANIVQLENQ EHDANIVPLK NQEQREDHQE TASALLVTPI  180
AAIPTETSQH PSFLIPSYSM VQLSTVGGTR VVLPITWVQM YNGINYGTLV QQPLSSYCSS  240
NLTLG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLK4CZ333e-34K4CZ33_SOLLC; Uncharacterized protein
STRINGSolyc10g019150.1.18e-34(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74541230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.21e-16MYB_related family protein